SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN17210 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN17210
Domain Number 1 Region: 101-173
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.92e-24
Family Skp1 dimerisation domain-like 0.0003
Further Details:      
 
Domain Number 2 Region: 19-88
Classification Level Classification E-value
Superfamily POZ domain 3.45e-17
Family BTB/POZ domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN17210
Sequence length 207
Comment (Caenorhabditis brenneri)
Sequence
MSAEAVPVVTDAAAPEGMYYRIAGNDGVEFKVSELAIQQSETLNRLITTMCYTAEDVEKK
DAIPIENIDGETLKLVFEWCEHHKGEPIPEDDDSVPKNVVIPEFDAKLMEIDNERLFNLI
CAANYLNIKQLLNVSCKKVANMAKGKSPEEMRILFEIPTDEEDEAAEKAAKEAEEKAAKE
AAEKKAAEKHTTVEDAKKDVQGTSDSA
Download sequence
Identical sequences G0NL58
CBN17210 135651.CBN17210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]