SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN17524 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  135651.CBN17524
Domain Number - Region: 56-141
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00102
Family Myosin rod fragments 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN17524
Sequence length 210
Comment (Caenorhabditis brenneri)
Sequence
MQRFSRLDEYVNRFTDALLKDEFRVCALKKLISMNLTSETYRRFEISECSSLLLQAGSCT
ELCKQLLQKIEKVAQEERGCRKRAREMSRSSEENEEPVGKKMKEGSQFEQYVDELTDAVV
DDEKNREFALKKLLSLNLTLDTYRRFEVGTLASVLIEAESSSFDEEEETVCKKERIVPDE
EEKLEVPQEAEEIPRRSTRQRVPKKIWEDP
Download sequence
Identical sequences G0MPF1
CBN17524 135651.CBN17524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]