SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN17535 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN17535
Domain Number 1 Region: 6-114
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000000445
Family MATH domain 0.017
Further Details:      
 
Weak hits

Sequence:  135651.CBN17535
Domain Number - Region: 128-175
Classification Level Classification E-value
Superfamily POZ domain 0.0149
Family BTB/POZ domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN17535
Sequence length 243
Comment (Caenorhabditis brenneri)
Sequence
MDSLSLITSGPQEHFGVQWIIFISRNVENCASMCLEPEIMTTDDEPWWIIADFQVKVIGS
NRYYLKEGSKRFTNFESDDKFWPLMGWNKLMDDYVNEEDKLTVEVKIRIVKMSGVYKQNL
RCFDETMKLFSDLMFEVQDVKFYVAKLTTVEGILFVADIYNTPIVTGKCEKFLWKKSQRC
ASKLIELSSRYSLEKLKTNCISAIEHMDVPQILELTTEDSENWDAEIKDKFEKRLIELGN
IYS
Download sequence
Identical sequences G0MD58
CBN17535 135651.CBN17535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]