SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN17627 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN17627
Domain Number 1 Region: 10-114
Classification Level Classification E-value
Superfamily POZ domain 1.26e-24
Family BTB/POZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN17627
Sequence length 182
Comment (Caenorhabditis brenneri)
Sequence
MSKTPEPSIYEKAFAKSDKTDAILVVQGKKLHVNKALLSIHSDYFNTLFNSEFKEKSMEE
IPIKDVKFEDFATVLSLVHPNRIEPTVNNVENLLKLADRFLLPSVKRYFELFIISTDIPA
ASKLRLTDQFELETLMEHSLKLFNTNSVLSAQTLQKFSDKTKVRLFNRKLALNRGGRDTR
IF
Download sequence
Identical sequences G0MVV4
135651.CBN17627 CBN17627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]