SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN17672 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN17672
Domain Number 1 Region: 32-173
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.73e-26
Family Galectin (animal S-lectin) 0.0018
Further Details:      
 
Domain Number 2 Region: 178-311
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.9e-24
Family Galectin (animal S-lectin) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN17672
Sequence length 311
Comment (Caenorhabditis brenneri)
Sequence
MASIFRRLLSIRKPKKVLTRKDSITGRNHTFEVPYLSRLDGNQLQPGQSLIARGYITGAD
GFIINLTSGPNVELDEDETGELDDRLLALRVDLTKGKVYLNACINGQWGKEAFVKQQYKE
GDEFDIRVRCFEQHFEIYVEHKLIATFKHYVPMSNISHIYVTGDVRLYAVSWEGKLYNMP
YTADIPGNFYVGRKLFVSAIAEKKPKDLTIDFFAGEDVPFKLCASFIQKKVTRCSEISGV
KSSPETNFEGKIKFPLKAKRSFDILIYAADDKFLVFINDVLYCTFEHRMPAVKIERLQIN
GDIQLIGVHIK
Download sequence
Identical sequences G0NMQ4
CBN17672 135651.CBN17672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]