SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN17988 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN17988
Domain Number 1 Region: 54-146
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.52e-21
Family Cold shock DNA-binding domain-like 0.0003
Further Details:      
 
Domain Number 2 Region: 142-209
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.91e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN17988
Sequence length 226
Comment (Caenorhabditis brenneri)
Sequence
MTVYLPGDVIDEPSSSDSLITGYGINLRGQQKVSTQPGAFRNDGGKVWLNVHSKRYIPQE
GDRVIAIVTSKTGDFFRLDIGTAEFAIINFTNFEGATKRNRPNLKTGDIIYATVFDTTPR
TEAELTCVDDEKRARGMGQLNGGYMFKVSLNHCRRLINPSCKILQTTGKFFKFEITVGMN
GRIWINAPTTDDIIKIHDILNKSEFITDDDELISLVQNSYTRSVID
Download sequence
Identical sequences G0NXZ2
CBN17988 135651.CBN17988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]