SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN18074 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN18074
Domain Number 1 Region: 153-216
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000714
Family BTB/POZ domain 0.0058
Further Details:      
 
Domain Number 2 Region: 9-133
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000000000491
Family MATH domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN18074
Sequence length 225
Comment (Caenorhabditis brenneri)
Sequence
MINEQVPIKEFTLTDVIKNYHELRQNQLMVSENVDHFNVPWATAYYKDEHGLSLYLSCSK
EDKDKEWSIDTNVEFYIISAKGNWKKSIQSLNVEFNNNRGSDKFGIDEFVSNNEMKDDFL
VRNEVVVEIKVQILRMSGIDKKQQLKSFDDKEAEKLSDMTLCVDDKRFHVSKLLLASQST
HFSSIISEKARKRKFKVTLDGIDANTFQTFLEVMYLEPTLTEEMH
Download sequence
Identical sequences G0NYU0
135651.CBN18074 CBN18074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]