SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN19195 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN19195
Domain Number 1 Region: 115-182
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 7.32e-20
Family Skp1 dimerisation domain-like 0.00061
Further Details:      
 
Domain Number 2 Region: 36-104
Classification Level Classification E-value
Superfamily POZ domain 7.46e-19
Family BTB/POZ domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN19195
Sequence length 213
Comment (Caenorhabditis brenneri)
Sequence
MTSAMFPDQSSTFNMSEESSLVAAAPDTDAAPELLYKVQSSDGKEFKVSELAIQQSETLG
RLIETMEYTAEDVETKPPIPLENISGDTLDLVFKWCEHHKGEPIPVDDGSVNVVISEFDK
KLMDIDNMKLFHLMCAADYLSIKQLLNVSAKKVADMTKGKTPEELRKFLEIPTDEEDEAA
QRAAVAEQEAAARRAAGEGPSGDAGEGSKNAST
Download sequence
Identical sequences G0MZK1
CBN19195 135651.CBN19195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]