SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN19269 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN19269
Domain Number 1 Region: 104-171
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.28e-20
Family Skp1 dimerisation domain-like 0.00036
Further Details:      
 
Domain Number 2 Region: 31-93
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000051
Family BTB/POZ domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN19269
Sequence length 181
Comment (Caenorhabditis brenneri)
Sequence
MVKSPKSNKKGGKAVKVNNTVAVNENLDLIYTLISSDGEQFQADGHSLKLSKVLSLAAKC
LQSTETTIHVEKVKGDTLKRVLEWCENHKDDGPYVSKCGPGLRLPHWDFRWLKSLDNQQL
FDLITATNDLQMKQLMDYSCKTVANMAKGKSPEQLRQIFGILTDEEEAELALHEPGPSNA
N
Download sequence
Identical sequences G0PMQ5
CBN19269 135651.CBN19269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]