SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN19615 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN19615
Domain Number 1 Region: 3-69
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000471
Family BTB/POZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN19615
Sequence length 116
Comment (Caenorhabditis brenneri)
Sequence
MSIYEKAFEKSDKTDAVLLVDGKKLHVNKALLSYHSTHFKTLFNAEKSVKEVKIKDVNFK
DFAAFLSLVQDQPIIPTTLGAVSHRFGSLATGENSNRRQVRIGSSGGAWNQCVRKG
Download sequence
Identical sequences G0MVV8
CBN19615 135651.CBN19615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]