SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN20040 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN20040
Domain Number 1 Region: 37-76
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0000000000209
Family SNARE fusion complex 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN20040
Sequence length 145
Comment (Caenorhabditis brenneri)
Sequence
MDSATTSFAFSLGSNQLSGLVKGFDRLTGEPIEPEMEDPEVAAARRDQEKRRQDKHRRME
ADRERMRQQIRNKYNLKKKTEAAEHEIAGRIAGNRKTPEQVALESINTEEEDGIMTALND
TLEKAKSTVTSACTTMKNVVSLWKT
Download sequence
Identical sequences G0MBN0
135651.CBN20040 CBN20040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]