SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN20059 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN20059
Domain Number 1 Region: 27-154
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.59e-16
Family Calponin-homology domain, CH-domain 0.0081
Further Details:      
 
Domain Number 2 Region: 1389-1519
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000621
Family Extended AAA-ATPase domain 0.099
Further Details:      
 
Weak hits

Sequence:  135651.CBN20059
Domain Number - Region: 1195-1223
Classification Level Classification E-value
Superfamily BLRF2-like 0.0275
Family BLRF2-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN20059
Sequence length 1692
Comment (Caenorhabditis brenneri)
Sequence
MIQLLREESCRLHSIALVSLIMSTRERKKKKKMLTAYQLKWERKIYTDWANRQLSKGSLS
KPIRDLSNEFRDYRLVSQLINIIVPINEYSPSYTKKLAKITTNLDGLETCLEYLKNLGLD
CSKLTKTDIDSGNLGAVLQLLFLLSTYKQKLRQLKKDQKKLEQLPSAIMPPAVSKLPSPR
VPSTLSNQNSIQMSTSRLQTPQSRISKPTDSSKIGIKPKTSGLKPPSTSTSSSLTSNSFR
PSSRSSGNNNVGSTISTSAKSLDSSSTYSSISNLSRPAPSSQIQKPSRLQTQQVRVATTT
KIGSSKLAAPKAVSTPKLATVKTIKTEPENQGSGMLKLKLFSSKTASSSNNSPQPVRKVE
QSKIAAPVKTGLKPPTSSTSKLGSATSISKLSTPKVNYRKPDSIIQSDSKRCSKSSEEES
GYAGFNSTSPASSSSTEGSLSMHSTSSKSSTSDEKSPSSDDLTLNASIVTAIRQPIAAAV
SPNVINKPVEEKPTLAVKGVMSTTTKKETVSVQPTERNNQPTIGVVSPIMAHKKLPNESS
TPEKAESPPEKLESMSIDADMPPPPTPLKSFERVPPKMAPLRQPPTYDLLLKQGKITSPV
KSFGYEQVESSASEDSIVAHSQVQMTPPVHKISGNQSLERRMQKTKTSESSGYASDAGVA
MCAKMREKLKEYDDMTRRAQNGYPDNFEDSSSLSSGISDNNELDDISTDDLSGVDMATVA
SKHSDYSHFVRHSSSSSKPRVPSRSSTSVDSRSRVEQENVYKLLSQCRTSQRGAAATSSF
GQHSLRSPGYSSYSPHLTVSADKDTMSMHSQTSRRPSSQKPSYSGQFHSLDRKCHLQEFT
SAEHRMAALLSPRRVPNSMSKYDSSAAATALNASGMSRSMILLESLSPRPPRRHQSPAAS
CIVTNTASPSTRRSHSPRAPTARIPLSLASPVHVNDSNNRGSYSARSRGGSSTGIYGDFQ
LHRLSDEKSPAHSARSEMGSQLSLASTTAYGSLNDKYEHAIRDMARDLECYKNTVDSLTK
KQENYGALFDLFEQKLRKLTQHIDRSNLKPEEATRFRQDIAHLREISNHLATNSSSHNEG
AGELLRQPSLESVASHRSSMSSSSKSSKQEKISLSSFGKNKKSWALSVDSQIRSSLSKFT
KKKNKNYDEGHMPSISGSQGALDNIDVIELRQELKERDSALYEVRLDNLDRAREVDVLRE
TVNKLKTENKQLKKEVDKLTNNSTTRASSRASIPYIHEDEHVYDAACSSTSASQSSKRSS
GCNSIKVTVNVDIAGEISSIVNPDKEIIVGYLPMPASQSSWKEIDDSILDSFEKYLSRID
MDHQLDLDAKDAILGYQIGELRRVIGDSSTMIMSHPTDILTPTTTIRMFMHGAAQSRVDS
LVLDMLLPKQMILQLVKSILTERRLVLAGATGIGKSKLAKTLAAYVSLRTNQSEDKIVNI
TIPENNKEELLQVERRLEKILRSKESCIVTLDNIPKNRIAFVVSVFANVPLQSNEGPFVV
CTVNRYQIPELKTIPNFKMSVMSNRLEGFILRYLRRRSVEDEYRLNVQMPSELSRIIEFF
PVALQAVNNFIEKTNSVDVTVGPRACLNCPLTVEGSRDWFIRLWNENFIPYMERVARDGK
KTLGRCTSFEDPTDIVTEKWPWFDGPNPEDVLKRLQLQDLAPTPTNSSRQHFNPLESLIQ
LHATKHQTIDNF
Download sequence
Identical sequences G0MVF8
CBN20059 135651.CBN20059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]