SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN20230 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN20230
Domain Number 1 Region: 12-127
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000426
Family Tetramerization domain of potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN20230
Sequence length 140
Comment (Caenorhabditis brenneri)
Sequence
MVNEISFNCEDAWLNLFVGGEIHPVQVKTLMNPATCGTFFRDVVKVSDAAIKVRGVQWET
STNHIKYRVDIDRDGLLFRHVLQYLRNGKQTSLPDDTFTLEALICEADFFGLEKYREMLK
KKLWKLTGKRQYYACYEDSD
Download sequence
Identical sequences G0MLP6
CBN20230 135651.CBN20230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]