SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN20393 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN20393
Domain Number 1 Region: 101-172
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.44e-22
Family Skp1 dimerisation domain-like 0.00038
Further Details:      
 
Domain Number 2 Region: 19-88
Classification Level Classification E-value
Superfamily POZ domain 6.67e-16
Family BTB/POZ domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN20393
Sequence length 196
Comment (Caenorhabditis brenneri)
Sequence
MSAEAAPVVANAAAPDGMYYRIAGNDDVEIRVSELAIQQSETLQRLVTTMGYTAEDVEEK
PAIPIENVDGDTLKLVFKWCEHHKGEPIPEDDDSVPKKVEIPEFDAKLMDITSEQLFNFI
CAANYLNIKKLLDVSCKKVADMVKGKSPEEMRVIFQIPTDEEDEAAEKAAQEAQEKADKE
AAEKAEKDAQGTNSSA
Download sequence
Identical sequences G0NLA8
135651.CBN20393 CBN20393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]