SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN20397 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN20397
Domain Number 1 Region: 151-224
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.94e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Domain Number 2 Region: 48-119
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000438
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Weak hits

Sequence:  135651.CBN20397
Domain Number - Region: 249-288
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00154
Family beta-sandwich domain of Sec23/24 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN20397
Sequence length 518
Comment (Caenorhabditis brenneri)
Sequence
MREETAHKQQQMPGAWYYEEDNNASCSPVSDIDDIAQFLNYRTSIGVQNVTESVEVPTSE
HVAEIVGRQGCKIKALRAKTNTYIKTPIRGEDPIFVVTGRPEDVAEAKREIECAADHFTQ
IRASRRHSQGLLSWTSGGFSAFLVVPGAHAPGQVTVYVRVPLRVVGLVVGPKGATIKRIQ
QDTHTYIITPSREREPVFEVTGLPHNVDAARKEIETHIFQRTGNLPETEKDFSNVIGAGA
GGLGAVGSAHQHHQMLMQQKQQQHVVQQQQQLQAQQQAQQMMYQRKVAAAAALAGFGANN
NLFNQMGGAAATNGHHDLPFGMESSLGLDALLRSFPSMRNSLTPDHLQGFGRSCAAAAAA
AAAASSTGRLPGLTKMPSSSSTISSSRPSLGGQASLKHELPTYDYWGNNNSIHDIMENEI
LSASRKYDGNMMSSGWSTGAATAIGYEKEQMQLQQKMREESPTNGLMSLKGSSNSGFGFL
NTIWSDHNLSPGSLPSASASPASSNCDHNDHTLVPING
Download sequence
Identical sequences G0PCP0
CBN20397 135651.CBN20397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]