SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN20660 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN20660
Domain Number 1 Region: 3-64
Classification Level Classification E-value
Superfamily POZ domain 0.00000000031
Family BTB/POZ domain 0.002
Further Details:      
 
Domain Number 2 Region: 122-185
Classification Level Classification E-value
Superfamily POZ domain 0.000000000785
Family BTB/POZ domain 0.0012
Further Details:      
 
Domain Number 3 Region: 197-254
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.000000222
Family Skp1 dimerisation domain-like 0.0044
Further Details:      
 
Weak hits

Sequence:  135651.CBN20660
Domain Number - Region: 70-108
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.0157
Family Skp1 dimerisation domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN20660
Sequence length 254
Comment (Caenorhabditis brenneri)
Sequence
MSFYIISSNDGRKFRVPANAAKHSETVMECISENNIAPNSPIAMQQPVSGMMLDRIISWC
EHHKYGSVPSEITEWDRNLLTTENRIERMNLISAAGLMRIKELKRMSIALFCERETTQDT
GFIQLQSKDTHVFQMTLGAAKQSLLLAQILEKLSGKAPVLPIPIDFTSAQLDVVVKWCEH
HRGEPISVLDDDGYPFNVLVPEFDKNLLKIGNADLVKVMNAATALEINALIRSATKTWFD
RQRSMTQEELSALF
Download sequence
Identical sequences G0NLZ2
135651.CBN20660 CBN20660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]