SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN20829 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN20829
Domain Number 1 Region: 76-181
Classification Level Classification E-value
Superfamily POZ domain 4.19e-21
Family Tetramerization domain of potassium channels 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN20829
Sequence length 224
Comment (Caenorhabditis brenneri)
Sequence
MALLIAPTVAAQIASGSTSMAAGSGCERENSVDNQPDRASIDDRSSNKMYDEDVESRMIP
LERPSHKGSIRDNTPDSILRLNIGGSSYRIRTRSIIKFGPKTLLGRFCRMNHEHRRQWAD
WYFEDQDEYFFERVPRYFDPIYDFYATGKLHVPKDLCFDKFMAELRFWAVSKSRMDECCS
PFAQYCVTMGGDPKYTVGTVIQGELGWLGYHCIASASTGTPGGS
Download sequence
Identical sequences G0P7Z5
135651.CBN20829 CBN20829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]