SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN20894 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN20894
Domain Number 1 Region: 76-181
Classification Level Classification E-value
Superfamily POZ domain 2.88e-21
Family Tetramerization domain of potassium channels 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN20894
Sequence length 196
Comment (Caenorhabditis brenneri)
Sequence
MALLIAPTVAAQIASGSTSMAAGSGCERENSVDNQPDRASIDDRSSNKMYDEDVESRMIP
LERPSHKGSIRDNTPDSILRLNIGGSSYRIRTRSIIKFGPKTLLGRFCRMNHEHRRQWAD
WYFEDQDEYFFERVPRYFDPIYDFYATGKLHVPKDLCFDKFMAELRFWAVSKSRMDECCS
PFAQYCVTMGGDPKYT
Download sequence
Identical sequences 135651.CBN20894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]