SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN21270 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  135651.CBN21270
Domain Number - Region: 19-61
Classification Level Classification E-value
Superfamily POZ domain 0.00596
Family BTB/POZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN21270
Sequence length 129
Comment (Caenorhabditis brenneri)
Sequence
MSAEAAPVVADAVAPEGMYYQVAGNDGMEFKVSELAIQQSETSNPLVSTMGYTAEDVEKK
EDFLNKNIYDEPILKLMFPEYDTTVKEMINQEVFKMIERAIILIEEQAAQEMGAKEAAEK
DVQGTNDSA
Download sequence
Identical sequences G0NQK8
CBN21270 135651.CBN21270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]