SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN21294 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN21294
Domain Number 1 Region: 1-123
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.3e-19
Family Galectin (animal S-lectin) 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN21294
Sequence length 178
Comment (Caenorhabditis brenneri)
Sequence
MEVGDRFVVNGVVNQAAGIVRINLANNQTNDIAIHMRADIHLNRFIWDSFINGQWTGQEH
SPLPYRAGQPYEVSMELTQTTFEINFNGNHLYSYRKRTPSYHQTSTAQLFGTHTTNWIEL
VCKNSPVTPTRPPRPPRPSPGRPPRPGHGGGNGYGGHGHGRRYDDNSSGSSSSSDESC
Download sequence
Identical sequences G0P2N5
135651.CBN21294 CBN21294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]