SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN21639 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN21639
Domain Number 1 Region: 97-159
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.19e-21
Family Skp1 dimerisation domain-like 0.00031
Further Details:      
 
Domain Number 2 Region: 20-85
Classification Level Classification E-value
Superfamily POZ domain 1.38e-16
Family BTB/POZ domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN21639
Sequence length 182
Comment (Caenorhabditis brenneri)
Sequence
MVLFGNEGSSKVDKNLDECFILVSSDKKEFPISQQAIKHSKTLAQMISTLNISTNSDEKR
IPVENVQGEHLDLIVQWCEHHKEEPVLEDEKSIDQDFKIPDWDRTFLEVDNETLFHFICA
ANYLDIELLMIIACKTVALMAKGRTPEEMRVIFGVNVDEEEQLMMQTNAAPQVEIVEAEG
EE
Download sequence
Identical sequences G0NAX1
CBN21639 135651.CBN21639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]