SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN21800 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN21800
Domain Number 1 Region: 1-122
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.29e-27
Family Calponin-homology domain, CH-domain 0.0000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN21800
Sequence length 132
Comment (Caenorhabditis brenneri)
Sequence
MRAYTLSVLGKCTRDGGVPTDKDILEWANKKLSSNGKSSSIRSFQDRTISSASVVLDLID
TIKQGVVGIQLVKDDNSKEGKMDSAKYAITCGRKIGAGIYALPEDIVEVKPKMVMTVFAC
LMAQDFKMHSLI
Download sequence
Identical sequences G0NKF5
135651.CBN21800 CBN21800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]