SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN22799 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN22799
Domain Number 1 Region: 93-180
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000000916
Family MATH domain 0.016
Further Details:      
 
Weak hits

Sequence:  135651.CBN22799
Domain Number - Region: 196-218
Classification Level Classification E-value
Superfamily POZ domain 0.0165
Family BTB/POZ domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN22799
Sequence length 269
Comment (Caenorhabditis brenneri)
Sequence
MSTEQVAIQEFTLTEVFQNFSQIKMNVQNFTDKGRSRTVSPGFLRYFVVNAMSANFWTSI
VGRLSPIECACQIRSVYVFRYKSSRNICYVKMAGQFAVYVHCVKARGNEDWSIKTRCQVS
MTSIHGKSSSKQFDATFTNKSDCPGQGLYDFIPMDELRHNLVISDQVVLEARVEILEMTG
IEMPPSLKYFDDNEAKKMSDVTLLVEDKRFHVSKFTLVDVRACMGCGGLENGVKDPEMQS
SLTNIFQEIEKKIIAMYLAQYHAQFFPRL
Download sequence
Identical sequences G0MD25
135651.CBN22799 CBN22799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]