SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN22873 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN22873
Domain Number 1 Region: 151-211
Classification Level Classification E-value
Superfamily POZ domain 0.00000000118
Family BTB/POZ domain 0.014
Further Details:      
 
Domain Number 2 Region: 31-126
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000000196
Family MATH domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN22873
Sequence length 213
Comment (Caenorhabditis brenneri)
Sequence
MSIIGKKFLLEHCFQEINSMEEQEMVMGPIEEHLGIPWQLSVKRNEGHLNVVVNCNLPKD
NKTWSINTEVKGELVSSKGGIIVKNFRPAYTSTGDTNTGDAFLSWESLENDYLIDGSFHI
YVEVKIKKGSGLPKKKLIHFDSPEPNVIQGLLIVEGEKFYVDRMFLASKSTEFNKLFFGK
EENLENNEFQLNDVRVSDFQNFLEDVYHAKVID
Download sequence
Identical sequences 135651.CBN22873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]