SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN23153 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN23153
Domain Number 1 Region: 12-79
Classification Level Classification E-value
Superfamily POZ domain 0.000000133
Family BTB/POZ domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN23153
Sequence length 139
Comment (Caenorhabditis brenneri)
Sequence
MGQPAQQLLFANSNQNRHDHRGQFQEIRCTDQFSDMCLEVGTGKFHVAKWLLINQSARFK
KMLKQGDLNEIKECENLSKEKSKRSIKDIYRLGNVFEMPEVKFCPKPSVKTETKKRQVRN
TEDENEEDDVDGMPLNRRK
Download sequence
Identical sequences G0NS44
135651.CBN23153 CBN23153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]