SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN24368 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN24368
Domain Number 1 Region: 237-412
Classification Level Classification E-value
Superfamily MIR domain 5.62e-39
Family MIR domain 0.001
Further Details:      
 
Domain Number 2 Region: 1092-1225
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-22
Family SPRY domain 0.016
Further Details:      
 
Domain Number 3 Region: 4363-4441
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000536
Family Calmodulin-like 0.038
Further Details:      
 
Domain Number 4 Region: 683-813
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000871
Family SPRY domain 0.038
Further Details:      
 
Domain Number 5 Region: 121-200
Classification Level Classification E-value
Superfamily MIR domain 0.000000017
Family MIR domain 0.02
Further Details:      
 
Domain Number 6 Region: 2313-2393
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000131
Family IP3 receptor type 1 binding core, domain 2 0.019
Further Details:      
 
Weak hits

Sequence:  135651.CBN24368
Domain Number - Region: 449-556
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000445
Family IP3 receptor type 1 binding core, domain 2 0.0079
Further Details:      
 
Domain Number - Region: 1590-1714
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00116
Family SPRY domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN24368
Sequence length 5268
Comment (Caenorhabditis brenneri)
Sequence
MDFDFTDISDEDHNYVTKGDIVCLSCVASHNRDGVLGSERVCLCTEGFGNRMCTLENVSD
KDIPPDIAMCMLYIDNALSMRALQEMMSADSDHVSIYVVEIKKTKLIQKSASGAGGHKTL
LYGHAVQLKHVQSEMYLACLSSCSSNDKLAFDVGVQETNEGEACWWTIHPASKQRSEGEK
VRVGDDVILVSVATERYLHMAYSKGYMVIASFHQTLWNIQSVSSGSMRTRNMGFLFGNDV
LRLFHGNDECLTIPENWSEHPQHNMVIYEGGAAVTQARSLWRVELVRMKWHGALVGWEQV
FRIKHITSGRYLGVLDNAVQLYHKEKADFELTAFVMCQNKDPKKQMLDEKEEEGMGNATI
RYGETNAFIQHVKTQLWLSYQTSEVTKKGLGKVEEKKAVALKDGHMDDCYTFFMALEEES
KSARVIRKCSSVLNKFLKGIDALQLEGNKSADWTRVDLNEVLKLMEDLIEYFAQPNEEQD
FEEKQNHLRALRSRQDLFQEEGVLNMILDTIDKFSQMEALPDFADLIGEDTHITWEQIST
YLYLLVAAMIKGNHYNCAQFASAQRLDWLFGRLSNPQSAEGILDVLYCVLTESPEALNMI
NEGHIRSVISLLEKVGRDPKVLDVLSSLCEGNGMAVRSSQNLITQYLLPGKDLLLQTSMR
DHVSSMMPNVMLGVVEGSALFRKWYFEAEVEHIETMTKQTPYLRIGWANSVGFKPFPGSG
DKWGCNGVGDDFYSYGFDGKSMFFGGKSRIVGHKLLEKGDVVGCSIDLTVPEIKFSVNGT
YLSGVFKKFNIDGYFFPVMSLSAKVSCRFILGGNQGRLRYGPPPGFSAVVEAVNGELGIT
DCLSFGDLGKNIFCGPQTIFNNLEPFIPTPIDVSTTQLTHHAMEMHQKYAENLHELWAMR
KIELGWSYGENRSETSRKHPCLTRFELLPETEKKYNIMLALTTMKTIEALGYHLITDDPP
CRLRAVRLQQNFQQSNGYKPGPLDTHEIQLPAELQPLTEALARNTHNVWAKEKIKRGWTF
GLSEHVDATQKRSPHLVPYEQVDERIKQANRESAAENIRALQLFGIFLEPPAHEHDEVAE
KELRARKDNTRTYRAEATYAVNGGKWYFEFEILTAGYMKIGWMDVGSTPEIQLGADDRSY
AFDGYLGRKWHQGAETYGKEWKIGDVVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNV
VCGDGLVPAMTLGSGQRGRLNFGQQSNSLKYFTTCGLQEGYEPFCVNMYRTMPMWFAKQL
PRFEDISALKSGSLLEVSRIPATGTSPPCLKILQKVTISEGGPSEKAKMEYIRLSLPVKC
NDTFVKNKDKDAIRRQLQDYKPRSQSVVSQIRAPGIPKEFEENKEKKGFLRSMLGSKDSH
ESDDDRRSRTTSKQPSIEGDEPPAVRRSLLELPHEERQIAEDHMRDMSDRHAEKPKKGGI
LSRLRDSSNTRKKDSDRRKDKEAALRQMKSNSRSFDAGSLDTSTLPTGQKDVLEEESEEQ
DPIWVLQDQFHDEDTVSASSEMPLSGPGRQLTIKRGSIKKNKKGKKTEIAMEKVNMEKKG
SIIPMEAQLDVLQEGDAHALVALKDKVDEYYYGLRIFPGQDPSQVWVGWVTTQYHYYNLN
FNGSQGVRKCRFSEADHHGTTVDSVQSQNCYMVNVSELLATTQDVQNTKVLGTLIGCIID
TSIGELSFQVGTTDTGIKFKLEPGAMLFPAVFVTPTAAELVQFELGRIKYTFPLSAAMFK
SCEKSLVPFCPPRLSVEQIEPVYWARVPNETLRTTALKLSEVRGWSVLCNDPVRIMSVYI
PEKDQSLDILEMIEMPDMLEFHRQTLNLYCKLASHGNHKVAHTLCQHIDEDQIMYAIKSH
YLSGPMRQGFHDLLIGLHLMSHTAARNSMAKEYVIPLVPQLQIKNVLDPDSESRYPQITG
QSVSMLSQMASEPVKKHVSREDEMKLLPPSVDFDALKKHVMESLQSATHHAVMNCRDLIG
GDNTNHFEPLFKLFDQLLVIGLINDEELEFLLRLIHPQAFDETYENGTTQKGLTQLELAE
PVKLQLVSILDHLCDIQLRYRIESLVAFTEGFVGELQSDQCKRYMEIKQTDMPPAEAAKK
TKEFRCPPKEQMFRLLMCKMKEEKDPELMEEDADVDQCPMAESLQQQLRDFCELLVGKIG
NSKEGDTEEQLALIESEEGSWVDSFARIVVKVPPPLVEEGLEMQKKGTQNFREIIVTMLR
EWAQADFIESKDLIRCMFKLLLRQYSGIREIRDAMSQTYVFHERNAGDVTDFIVYLIQIR
ELLTVQFEHTEEAILKRGLWKLMNNRIFFQHPDLMRLLSVHENVMSIMMNILTAQQGTVE
HEGDEVKEKAPIKDASEMVVACSRFLCYFCRTSRQNQKAMFEHLSFLLDNATMLLARPSL
RGSVPLDVAYSSFMDNNELALALKEEELDKVAVYLSRCGLQPNSELITKGYPDIGWDPVE
GERYIDFLRFCVWINGENVEENANLVIRLLIRRPECLGVALKGEGQGLFSAFKEAIALSE
DIRLLENDSHPSLLTSGLLGENPTYPSKDAEGEDYIDLGAATLDFYSSLVDLLAKCAPDP
MAIQAGKGDSLRARAILRSLISLEDLGQILALRFTIPNLAAPSLEAVRRANAVQASHTQK
AVMAHTFAMVASLASEVSNTRRSQTFTSGTNLARRGLPCVEEVDTDDSKSSDYASVHTSF
SSGNELFVPKAEKEKAELQLLNEKKYPIVQRRRSSRYNPIDNTGPLPGLLPNHKGSVLLF
LDRVYGIDQQDSLFTVLEQSFLPDLRAATMMDSPRALESDTALALNRYLCNSVLPLLTNH
SHFFADAEHHSALLDATLHTVYRMNRLKSLTKNQRDAVSDFLVAITRELPPAMMIKLLKK
VINDILTMNDMNVLVPLRLITLHYERCGKYYGSGNHYGVASEQEKRLSMLLFDAIFDTLG
SRPYDPELFGKALPCMTAIGSAISPDYTLTSGLEDVRNKKREEEGAWIPRTVDVSRCEIN
RDLEKMTELFAEHFHDSWASRKIEKGWAHGDLYSRANKTHPRLKPFSLLKDFEKSFYKER
CSECIKALMAWNYTFEMIDRDANDRASAARTLSGTSISNFAPKPIDLSSMTLEKDMVNAA
EKMAEHSHLVWAKKVMNDLNNKGGFMPIPLVPWDLLTDFERRKDRFRSSEILKFLQYHGY
HVNCPKDEQSQNDRMKSEGERSSVEKRFAYNLLEKLITYLEQASLKMKSVKPSQELTRRN
SFKKEGQDVKFFEKVVLPLMHAYFNAHKNYFLEGSSIVQTGTASNKEKEMVANLFCRLAA
LLRIKNRAFGSVAKITVKCLQGLTQALDLRTLVKVNSDIVRTSLLTFFNNCADDLYAAVN
ELKDGGQYSLIRGQALKSWNSFEFANQMIVPVLTTMFAHLARNHFGTDLLLDDIQAACYK
ILDSLYMVTGLNSSISHRKSISSESEKHRPGLGQCLAAFASCFPVAFLEPEFNKSNKFSV
LAKSQDQSVQVQEMLQNLSTHIPHLEKLLTDLETVSNNNTMYSDVPNVYDVDLPLMCSYM
AHWFSVGPDGKKDKDDQRASVVQTTSVSCDHINRIFNALLKMIRNHVGIENAPWLCRVNF
FAVQIIQNVTSDPVREFVLPIAERLRRMSEKAYKEEEHMRTHPDDADEGTVAEDNARLVR
DTYAFFPILMKYTDLHRAQWLKSPTWETDGVYENVAVIFRIWSQSQHFKREELNYVAQFE
EDAAAMGGGDMKTGKAAIAERKKKRREGQDKMKEYFDRNGRPIIKKDKHAASIVIACLKR
LLPVGLNVFGGRELDIVQQSKEKFIQKETEEKIREFIKGLLEIPVKTDPTDKNAWQLSLY
RKIGKYSCMFQRNLAYFTGKSQMRGKDEMSQEAVIEKIFNMGQVSAILHTITRTKDRRRR
AHHRWKTEHPQMQLSQAWKKVVSTQRKRAVVACFRMVPLYGIPRHRGINFFLPAFSRLWL
EEEDVGQDQLIADICSGVEEEEGPRIEIIMEEGVPIVASSEETKEKETNPDPLKQLIRCF
QRAATSEETAASAIHEDSLYIRFADVMAKSIHIEEEEEDGDEGEIDQAAKEEQSQALRGE
QAVLASRGAAIMCLMYLSASGGEPNEMVAQTLQLGIHLLSGGNVEIQKMLIEYLQLKKDV
RFFTSMAGLMNKCSVLNLEMFERQIKAEGLGMGAELASGDNQNLNDADFTCSLFRFLQLT
CEGHNLEFQNYLRTQPGHTTSVNLINCTVDYLLRLQESVMDFYWHYSSKEVIDEGGKEYF
LRAIQVCSQVFNTLTESIQGPCVGNQMTLANSRLWDAINGFFFLFAHMMEKLYKNSTQLE
LLREFLNLQKDMIVLMLSMLEGNVLNGSIGKQMVDALVESQPSVEKILKFSDMFLKLKDL
TTSQAFQDFDTNQDGWISPKEFQRAMESQKMYTVEDITYLMMCTDVNNDGKVDYMEFTER
FHNPARDIGFNLAVLLVNLKEHITNDPRLEKIIEKAQTLLEYFDPFLGRIEIMGSSKRVE
KIYFEIQESWLEQWGKQQIRDSKNSFLFNVLQDDGGDQGKLEAFINFCEDTIFEMQHAAA
ISSGDSDTKMERAIKQRDYFLQQTTASDHISETFKSGYNYGISAASALSPQNISTTMRNV
TTSIRQMTWTQLLYAIIILIIRAGMAIGWAGYLLLMTIFRFAYFLTTSSEEEEAAKQEKE
QAKMNHHEHPTFNPPVIQEFHHSHVGVDAFGVGMNADHLNVNSLPDFVPPPRPETPETVL
SEEEKPLNQDIPSPTSPAAASKAPSIYESIGAPQMVQLQSEADFQQGQYEPKIAESNSTK
TRGSILNMLARNFKTIEKITLYLAFFINVILLFHRVDITHTENPESASEGDDDEDALESI
FITGMQFPYIEYEITGWMLSQILYWISVLHLSTSFALLVSFYQLKIPLITFKREKEIARK
LMFDGCWITEEDSEELGIVDTFMWYLDRIVISAKSFPMMYWDKFVRRKTRSKFKDQVDEE
TLTSILGEEKMSTDSSYDYRYSCWLWLGVILTNGQFLYRVGYLLCSACGVFMSPFFYAFH
LIDVVLSFPMLKAILQSVTHNLQQLILTIMMTLVVVYLYTVIAFNFFRKFYVQEGEDGEE
PDRKCHNMLTCFIYHFYAGVRAGGGIGDELESPYGDDLEYPRMFYDISFFFFVIIILLAI
MQGLIIDAFGELRDQQESATEKLESSCFICDIGKETFDRMPRGFEIHTTKEHNFANYLFF
LQHLVNKDETEYTGQETYVREKYDNRDWDFFPVGECFVKQYEDQLLQS
Download sequence
Identical sequences 135651.CBN24368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]