SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN24563 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN24563
Domain Number 1 Region: 134-208
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.51e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Domain Number 2 Region: 48-118
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000468
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Weak hits

Sequence:  135651.CBN24563
Domain Number - Region: 232-268
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0034
Family beta-sandwich domain of Sec23/24 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN24563
Sequence length 499
Comment (Caenorhabditis brenneri)
Sequence
MREETAHKQQQMPGAWYYEEDNNASCSPVSDIDDIAQFLNYRTSIGVQNVTESVEVPTSE
HVAEIVGRQGCKIKALRAKTNTYIKTPIRGEDPIFVVTGRPEDVAEAKREIECAADHFTQ
IRASRRHSQGAHAPGQVTVYVRVPLRVVGLVVGPKGATIKRIQQDTHTYIITPSREREPV
FEVTGLPHNVDAARKEIETHIFQRTGNLPETEKDFSNAIGAGAGGLGAIGSAHQHHQMLM
QQKQQQHAVQQQQLQAQQQAQQIMYQRKVAAAAALAGFGANNNLFNQMGGAAATNGHHDL
PFGMESSLGLDALLRSFPSMRNSLTPDHLQGFGRSCAAAAAAAAASSTGRLPGLTKMPSS
SSTISSSRPSLGGQASLKHELPTYDYWGNNNSIHDIMENEILSSSRKYDGNMMSSGWSTG
AATAIGYEKEQMQLQQKMREESPTNGLMSLKGSSNSGFGFLNTIWSDHNLSPGSLPSASA
SPASSNCDHNDHTLVPISG
Download sequence
Identical sequences G0MM96
135651.CBN24563 CBN24563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]