SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN25262 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN25262
Domain Number 1 Region: 140-234
Classification Level Classification E-value
Superfamily POZ domain 1.05e-19
Family BTB/POZ domain 0.01
Further Details:      
 
Domain Number 2 Region: 32-124
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000116
Family MATH domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN25262
Sequence length 298
Comment (Caenorhabditis brenneri)
Sequence
MSTQTEKFVITQKFENVFGGDLDMQTGEGVEHFEIEWRIRVFPQSPHFAIDLDCFVGPDY
IKWAVDLKIEWRLLSETGWKPIETTEFEVKKRRNPKISFDWKRHGDCFTDDTLLVECHVE
IIRKKGMDRKSWRRFDESMKDFSDIVLLVEEERFYVSKLFLASQSSHFKSLILENPSDSN
ELIIDDVDALQFQHYLEMLYGHDPLDDDTVIFLLELGKKYDSPTVMEKCERYLIIESDMK
LLEELELAIRYQFDALKNDCLSELVTMDDIRRHMPEDISQLSQALITLILEKIISLHQ
Download sequence
Identical sequences G0P039
CBN25262 135651.CBN25262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]