SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN25980 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN25980
Domain Number 1 Region: 8-114
Classification Level Classification E-value
Superfamily POZ domain 4.79e-22
Family BTB/POZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN25980
Sequence length 179
Comment (Caenorhabditis brenneri)
Sequence
MTETPELTIYEKTFAKSDKTNAILVVQGKKLHVNKTLLSLHSDFFDTLFNSEFKEKAIEE
IDIKDVKFEDFATLLSLIHPNPLKPTEFNAEKLLELADRLLMTSVKQQLEWFLITTNISR
FTKLRIADKYQLDDLLQNAIDRIVKSDGFLTISNSNTFTNLSDKNKVKLLMHLLAANNQ
Download sequence
Identical sequences G0MVW5
CBN25980 135651.CBN25980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]