SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000000186 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000000186
Domain Number 1 Region: 54-276
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-72
Family Calnexin/calreticulin 0.0000000437
Further Details:      
 
Domain Number 2 Region: 262-400
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 2.55e-56
Family P-domain of calnexin/calreticulin 0.000000416
Further Details:      
 
Domain Number 3 Region: 403-447
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000839
Family Calnexin/calreticulin 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000000186
Sequence length 607
Comment (Monodelphis domestica)
Sequence
MQFQGFWLCLSLLLFTSVKAELQEEDVEMEDFEESSEEIMTNEDNIIPLEVKYKTPQPIG
EVYFTETFDNGILTGWVLSKAKKEDTDENIAKYDGRWEIEDLKENRVPGDRGLVLKSQAK
HHAISALLSKPFIFADKPLIVQYEVNFQNGMDCGGAYIKLLTENDYLNLENFFDKTPYTI
MFGPDKCGEEHKLHFIFRYKHPKTEVFEEKHAKVPNVDLKKFFTDKKTHLYTLVMSPDNT
FEVYIDQVIINQGSLLEDVEPPINPPKEIEDPNDKKPDDWDDRLEIPDNTSVKPEDWDES
QPSQIADPDAFKPVGWLDDEPEYIADPNAEKPPDWNENMDGKWEAPRIPNPACEIGCGHW
QPPMIDNPKYRGKWEPPMIDNPNYQGEWTPRKIPNPDYFEDRNPFLLTSFSALGLELWSM
TSDIYFDNFIICSDKEIADHWAEDSWMVKKLVARANEPGVFTQLLTAAEERWWLWIIYTL
TAGLPLVLITLFCWPRKKKDEDAEYKKTGIHKPQTKGALEQEVKEEKAALENVADLEEEK
ENQDDGEMEKEEEDETEEKSEGENETIEGQEEGNKSGSEDEMKEADESTGSGDGPVKSVR
KRRVRKD
Download sequence
Identical sequences F6XSA8
ENSMODP00000000186 13616.ENSMODP00000000186 XP_007496362.1.35504 ENSMODP00000000186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]