SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000000542 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000000542
Domain Number 1 Region: 8-135
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-45
Family Galectin (animal S-lectin) 0.00000435
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000000542
Sequence length 136
Comment (Monodelphis domestica)
Sequence
WSLQEILASNLNLKPGVCVRIVGDVLPDAKSFRLNLGKDHENLALHFNPRFDCFDDTNVI
VCNSRQEGSWGAEQRETSFPFLPGSQVEVCFAFEGSHFTVRLPDGSEFKFPNRLNLDTIN
FLEANGDFKLRSVNFD
Download sequence
Identical sequences 13616.ENSMODP00000000542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]