SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000000879 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000000879
Domain Number 1 Region: 28-211,289-449
Classification Level Classification E-value
Superfamily L domain-like 2.34e-61
Family Ngr ectodomain-like 0.00055
Further Details:      
 
Domain Number 2 Region: 500-666,722-875
Classification Level Classification E-value
Superfamily L domain-like 1.51e-46
Family Ngr ectodomain-like 0.00019
Further Details:      
 
Domain Number 3 Region: 1144-1333
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-40
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 995-1036
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000762
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 5 Region: 915-956
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000301
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 6 Region: 1072-1113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000526
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 7 Region: 958-1003
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000947
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 8 Region: 1037-1075
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000624
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 9 Region: 1329-1370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000013
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000000879
Domain Number - Region: 1419-1448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000133
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 1372-1408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000773
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000000879
Sequence length 1529
Comment (Monodelphis domestica)
Sequence
MCGFGFKKLSLSLGLVLVVLSEVAPQSCPAQCSCSGSTVDCHGLALRSVPRNIPRNTERL
DLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNKNNLQLFPE
LLFLGTSKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVL
TLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGLYTQCMGPS
HLKGHNVAEVQKREFVCSGHQSFMTPSCSVLHCPAACTCSNNIVDCRGKGLPEIPTNLPE
TITEIRLEQNSIKVIPPGAFSSYKKLRRIDLSNNQISEIAPDAFHGLRSLNSLVLYGNKI
TELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLR
AIQTLHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSA
KEQYFIPGTEDYRSKLSGDCFADLACPEKCRCEGTTVDCSNQKLNKIPDHIPQYTAELRL
NNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVRHK
MFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTIAPGAFDTLHSLSTLN
LLANPFNCNCYLAWLGDWLRKKRIVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNS
CSPLSRCPAECTCLDTVVRCSNKGLKALPKGIPKDVTELYLDGNQFTLVPKELSNYKHLT
LIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPARTFDGLKSLRLLSLHGNDISVV
PEGAFNDLSSLSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTT
PSKKFTCQGPVDVNILAKCSPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKGQDCDVPIHS
CISNPCKHGGTCHLKEGEKDGFWCTCADGFEGENCEVNVDDCEDNDCENNSTCVDGINNY
TCLCPPEYTGELCEEKLDFCAQDLNPCQHDSKCILTPKGYKCDCTPGYVGEHCDIDYDDC
QDNKCKNGAHCTDAVNGYTCICPEGYSGLFCEFSPPMVLPRTSPCDNFECQNGAQCIIKI
NEPICQCLSGYQGEKCEKLVSVNFVNKESYLQIPSAKVQPQTNITLQIATDEDSGILLYK
GDKDHIAVELYRGRVRASYDTGSYPASAIYSVETINDGNFHIVELIAMGQSLSLSIDGGS
PKTITNLSKQSTLNFDSPLYVGGMPGKNNIAALRQAPGQNGTSFHGCIRHLYINSELQDF
RKVPMQTGILPGCEPCHKKVCAHGTCQASSQSGFTCDCEEGWMGPLCDQRTNDPCLGNKC
MHGTCLPINAFSYSCKCLEGHGGVLCDEEEELFNPCQSIRCKHGKCRLSGLKQAYCECNS
GYTGESCDREVSCRGERIRDYYQKQQGYAACQTTKKVSRLECKGSCASGQCCGPLRSKRR
KYSFECTDGSSFVDEVEKVVKCGCTRCPS
Download sequence
Identical sequences XP_001368481.2.35504 13616.ENSMODP00000000879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]