SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000001571 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000001571
Domain Number 1 Region: 72-245
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-30
Family Laminin G-like module 0.0000000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000001571
Sequence length 426
Comment (Monodelphis domestica)
Sequence
GGGGGGGGGGGAGGRLALLWIVPLTLSGLLGVAWGASSLGAHHIHHFHGSSKHHSVPIAI
YRSPASLRGGHAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDS
SSGLGDYLELHIHQGKIGVKFNVGTDDIAIEENNAIINDGKYHVVRFTRSGGNATLQVDS
WPVIERYPAGRQLTIFNSQATIIIGGKEQGHPFQGQLSGLYYNGLKVLNMAAENDANIAI
VGNVRLVGEVPSSMTTESTATAMQSEMSTSIMETTTTLATSTARRGKPPTKEPISQTTDD
ILVASAECPSDDEDIDPCEPSSGGLANPTRAGGRDYPGSAEVIRESSSTTGMVVGIVAAA
ALCILILLYAMYKYRNRDEGSYHVDESRNYISNSAQSNGAVVKEKQPNSAKSSNKNKKNK
DKEYYV
Download sequence
Identical sequences F7BZM4
ENSMODP00000001571 13616.ENSMODP00000001571 ENSMODP00000001571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]