SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000001712 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000001712
Domain Number 1 Region: 323-385
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.56e-17
Family TFIIH p44 subunit cysteine-rich domain 0.00032
Further Details:      
 
Domain Number 2 Region: 56-225
Classification Level Classification E-value
Superfamily vWA-like 4.77e-17
Family Integrin A (or I) domain 0.03
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000001712
Domain Number - Region: 277-312
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0765
Family PhnA zinc-binding domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000001712
Sequence length 395
Comment (Monodelphis domestica)
Sequence
MDEEPEKTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRH
LYVVVDASRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTEL
SGNPKKHVASLKKAVDMTCHGEPSLYNSLSLAMQTLKHMPGHTSREVLIIFSSLTTCDPS
NIYDLIKSLKAAKIRVSVIGLSAEVRVCTVLARETGGVYHVILDESHYKELLTHHVSPPP
ASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDSSTEPGLTLGGYFCPQCRAKYSE
LPVECKICGLTLVSAPHLARSYHHLFPLDAFQEVSLEEYNGERFCQGCLGELKDQHVYIC
TVCQNVFCVDCDLFIHESLHCCPGCIHKNPAPTGV
Download sequence
Identical sequences F7BD00
ENSMODP00000001712 XP_001362699.1.35504 13616.ENSMODP00000001712 ENSMODP00000001712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]