SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000002127 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000002127
Domain Number 1 Region: 14-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-92
Family Calponin-homology domain, CH-domain 0.000000733
Further Details:      
 
Domain Number 2 Region: 2193-2311
Classification Level Classification E-value
Superfamily PH domain-like 1.8e-38
Family Pleckstrin-homology domain (PH domain) 0.00000301
Further Details:      
 
Domain Number 3 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 7.46e-36
Family Spectrin repeat 0.0000528
Further Details:      
 
Domain Number 4 Region: 602-741
Classification Level Classification E-value
Superfamily Spectrin repeat 6.84e-32
Family Spectrin repeat 0.00018
Further Details:      
 
Domain Number 5 Region: 1009-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-29
Family Spectrin repeat 0.0000216
Further Details:      
 
Domain Number 6 Region: 1861-2015
Classification Level Classification E-value
Superfamily Spectrin repeat 1.51e-27
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 7 Region: 810-949
Classification Level Classification E-value
Superfamily Spectrin repeat 2.3e-25
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 8 Region: 1456-1592
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-25
Family Spectrin repeat 0.00038
Further Details:      
 
Domain Number 9 Region: 1702-1805
Classification Level Classification E-value
Superfamily Spectrin repeat 9.03e-23
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 10 Region: 1597-1698
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-22
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 11 Region: 528-636
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-22
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 12 Region: 1138-1254
Classification Level Classification E-value
Superfamily Spectrin repeat 4.58e-21
Family Spectrin repeat 0.00009
Further Details:      
 
Domain Number 13 Region: 744-844
Classification Level Classification E-value
Superfamily Spectrin repeat 8.63e-21
Family Spectrin repeat 0.0006
Further Details:      
 
Domain Number 14 Region: 425-527
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-20
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 15 Region: 1278-1381
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-19
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 16 Region: 1386-1484
Classification Level Classification E-value
Superfamily Spectrin repeat 6.15e-18
Family Spectrin repeat 0.00039
Further Details:      
 
Domain Number 17 Region: 2020-2081
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000345
Family Spectrin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000002127
Sequence length 2364
Comment (Monodelphis domestica)
Sequence
MTTTVATDYDNIEIQQQYSDVNNRWDVDDWDNENSSARLFERSRIKALADEREAVQKKTF
TKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALL
LWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNL
AEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIET
EKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKG
NLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQA
VVAVAKELEAENYHDIKRITARDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIM
DWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIGIQAERVRSVNASAQKFATDGEGY
KPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKIL
SSDDYGKDLTSVVRLLSKHKAFEDEMSGRSGHFEQAIKEGEDMITEEHFGSEKIRERIIY
IREQWANLEQLSAIRKKRLEEASLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSL
VKKHKDVAEEIANYRPTIDTLHEQANALPQEHAESPDVQGRLSGIEERYKEVAELTRLRK
QALQDTLALYKMSSEADACELWIYEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQA
SRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHL
ECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKL
ESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQ
TAIASEDMPNTLAEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQ
RLQALDTGWNELHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTEMPTTLE
GAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDKIQEKVDSIDDRLLKKND
RNPRASEIEFSWLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQA
FMAELASNKEWLDKIEKAGMQLIAEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFD
ANKAELFTQSCADLDKWLNGLESQIQSDDYGKDLTSVNILLKKQQILENQMDVRKKEIEE
LQSQAQALSQEGKSTDEVDSKRLTVQTKFMELLEPLNERKSNLLASKEIHQFNRDVEDEI
LWVGERMPIATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNILTDSSSL
NAEAIRQRLTDLKQLWSLLIEETEKRHKRLEESHKAQQYYFDAAEAEAWMSEQELYMMSE
EKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADNHPESERISMRQSKVDK
LYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQE
RFREFARDTGNIGQERVDTVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRT
QILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGT
QVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKALLDACEGRRVRLVDTGDKFRFFS
MVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLL
ARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEP
YLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKR
QPPSPEPRTKVSEETESQQWDASKGEQVSQNGLPAEQGSPRMAETVETSEMVNGATEQRT
SSKESSPIPSPTSDRKAKTTIQAQTAATLPAKTQETPSAQMEGFLNRKHEWEAHNKKASS
RSWHNVYCVINNQEMGFYKDSKAASSGIPYHSEIPVSLKEASCEVAVDYKKKKHVFKLRL
NDGNEYLFQAKDDEEMNSWIQAITSAISSDKGEISVSTQSTPASSRAQTLPASVTITSES
SPGKREKDKEKDKEKRFSLFGKKK
Download sequence
Identical sequences F6X057
13616.ENSMODP00000002127 ENSMODP00000002127 ENSMODP00000002127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]