SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000002583 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000002583
Domain Number 1 Region: 360-472
Classification Level Classification E-value
Superfamily Cadherin-like 4e-31
Family Cadherin 0.00078
Further Details:      
 
Domain Number 2 Region: 1315-1536
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-30
Family Laminin G-like module 0.0055
Further Details:      
 
Domain Number 3 Region: 465-570
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-28
Family Cadherin 0.00086
Further Details:      
 
Domain Number 4 Region: 776-888
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-28
Family Cadherin 0.00075
Further Details:      
 
Domain Number 5 Region: 250-358
Classification Level Classification E-value
Superfamily Cadherin-like 1.2e-26
Family Cadherin 0.0011
Further Details:      
 
Domain Number 6 Region: 1559-1755
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.62e-26
Family Laminin G-like module 0.02
Further Details:      
 
Domain Number 7 Region: 145-248
Classification Level Classification E-value
Superfamily Cadherin-like 3.8e-26
Family Cadherin 0.0015
Further Details:      
 
Domain Number 8 Region: 876-991
Classification Level Classification E-value
Superfamily Cadherin-like 6e-26
Family Cadherin 0.0016
Further Details:      
 
Domain Number 9 Region: 667-774
Classification Level Classification E-value
Superfamily Cadherin-like 1.01e-25
Family Cadherin 0.0018
Further Details:      
 
Domain Number 10 Region: 570-671
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-21
Family Cadherin 0.0014
Further Details:      
 
Domain Number 11 Region: 984-1086
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000006
Family Cadherin 0.0056
Further Details:      
 
Domain Number 12 Region: 1242-1332,1523-1572
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000204
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 13 Region: 1888-1927
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000001
Family Laminin-type module 0.0094
Further Details:      
 
Domain Number 14 Region: 1794-1840
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000568
Family EGF-type module 0.013
Further Details:      
 
Domain Number 15 Region: 1759-1793
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000743
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000002583
Domain Number - Region: 2397-2606
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00211
Family Rhodopsin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000002583
Sequence length 2889
Comment (Monodelphis domestica)
Sequence
PCRSLEALDLSSPHLCIPQHWFCPAGNEGHWLHTSRCRARGPELTSRLVPLERFRGRRAW
CPEPGAHIPLPPAPRGCPWSCRLLGARGHISPQGKLTLPPGHQCIQVPQLQCQLCRVAWA
QGHWVEKWMAGDLPGSRRKRNVNTAPQFQSPVYQATVPENQPVGTPVASLRAVDPDEGEA
GRLEYTMDALFDSRSNQFFSLNPATGAVTTAEELDRETKSTHVFRVTAQDHGTPRRSALA
TLTITVTDTNDHNPVFEQSEYKESLRENLEVGYEVLTVRATDGDAPPNANILYRLVEGPG
GSPPEVFEIDPRSGVIRTRGPVDRETVESYQLTVEASDQGRDPGPRSATAAVCLSVEDDN
DNAPQFSEKRYVVQVREDVTPGAPVLRVTATDRDKGSNALVHYSIMSGNARGQFYLDAQT
GALDVVSPLDYETAKEYTLRIRAQDGGRPPLSNVSGLVTVQVLDINDNAPIFVSTPFQAT
VLESVPLGYLVLHVQAIDADAGDNARLEYRLAGVGPDFPFTINNGTGWISVAAELDREEV
DFYSFGVEARDHGTPPLTASASVSVTILDVNDNNPTFTQPEYAVRLNEDAAVGTSVVTVS
AVDRDAHSVITYQIASGNTRNRFSITSQSGGGLVSLALPLDYKLERQYVLAVTASDGTRQ
DTAQVVVNVTDANTHRPVFQSSHYTVNVNEDRPAGTTVVLISATDEDTGENARITYFMED
SIPQFRIDGDTGAVTTQAELDYEDQVSYTLAITARDNGIPQKSDTTYLEILVNDVNDNAP
QFLRDSYQGSIYEDVPPFTSVLQISATDRDSGLNGRVFYTFQGGDDGDGDFIVESTSGIV
RTLRRLDRENVAQYILRAFAVDKGVPPARTPVEVMVTVLDVNDNPPVFEQDEFDVFVEEN
SPIGLAVARVTATDPDEGTNAQIMYQIVEGNIPEVFQLDIFSGELTALVDLDYETRAEYI
LVIQATSAPLVSRATVHVRLLDRNDNPPVLGNFEILFNNYVTNRSSSFPGGAIGRVPAHD
PDVSDTLSYSFERGNELSLVLLNASTGELRLSKALDNNRPLEAIMSVSVTDGAHSVSAQC
VLRVTIITDEMLTHSITLRLQDMSPERFLSPLLGLFIRGVAATLATPPDHVVVFNVQRDT
DAPGAHILNVSLSVGRPPGPGGGPPFVPSEDLQERLYLNRSLLAAISAQRVLPFDDNICL
REPCENYMRCVSVLRFDSSAPFIASASVLFRPIHPVGGLRCRCPPGFTGDYCETEVDLCY
SRPCGPHGRCRSREGGYTCLCREGFTGEHCEVSARSGRCAPGVCKNGGTCVNLLVGGFKC
DCPSGDYEKPYCQVTTRSFPARSFLTLRGLRQRFHFTLALTERDGLLLYNGFNEKHDFVA
EVIQEQVQLTFSAGESTTTVSPFIPGGVSDGQWHTVQLQYYNKPLLGRSGLPQGPSELKV
AVVTVDDCDPGVALRFGAVLGNYSCAAQGTQAGSKKSLDLTGPLLLGGVPDLPESFPIRT
RHFVGCMRNLQVDSRRVDMADFIANNGTVPGCPAKKNVCDSNTCHNGGTCVNQWDTFSCE
CPLGYGGKSCAQEMANPQRFLGRSLMAWHGLALPITQSWHLSLMFRTRQADGVLLQGITR
GHSTITLQMTEGHVMLSVEGTGVQTSSLRLEPGRANDGDWHHVQLVLGVSGGAREPGHAV
LSFDYGRQQAEGNLGPRLHGLHLTNVTVGAVAGPGGTVAQGFRGCMQGVRVGEAADGASS
LDPSRAERANVEQGCSLPDPCDSSPCPPNSYCSDDWDSYSCSCDPGYYGDSCANVCTLNP
CEHQSVCTRKPSAPHGYTCECPHNYFGPYCETRIDQPCPRGWWGHPMCGPCNCDVSQGFD
PDCNKTSGECRCKENHYRPLGSPACLLCDCYPTGSLSRVCDPEDGQCPCKPGVIGRQCDR
CDNPFAEVTANGCEGEYAVNYDSCPRAIEAGIWWPRTRFGLPAAAPCPKGSFGTAVRHCD
EHRGWLPPDLFNCTSVTFSELKGFAERLQRNESGLDAGRSQRLAVLLRNATQHTAGYFGS
DVKVAYQLATKLLAHESVQRGFGLAATQDVHFTENLLRVGSSLLDVGNKRHWELIQQTEG
GTAWLLHHYEAYASALAQNMRHTYLSPFTIITPNIVISVVRLDKGNFAGAKLPHYEALRG
ERPPDLETTVILPESVFKPTESQGGPVVPGEAREQEELGRRQRRHPELSQGQAVASVIIY
RTLAGLLPHNYDPDKRSLRVPKRPVINTPVVSISVHDDEDQLPRALDKPVTVQFRLLETE
ERSKPICVFWNHSILVSGTGGWSARGCEVVFRNESHVSCQCNHMTSFAVLMDVSRRENGE
ILPLKTVTYAALGVTLAALLLTFLFLASLRALRSNQHGIRRNLVAALGLAQLVFLLGINQ
ADLPFACTVIAILLHFLYLCAFSWALLEALHLYRALTEVRDVNTGPMRFYYMLGWGVPAF
ITGLAVGLDPEGYGNPDFCWLSIYDTLIWSFAGPVAFAVSMSVFLYLLAARASCAAQRQG
FEKKGTVSGLRSAFVVLLLLSATWLLALLSVNSDALLFHHLFAACNCVQGPFIFLSYVVL
SREVRKALRFACSHKPSPDPALTTKSTLTSSYNCPSPYVDGRLYQPYGDSAGSLHSASRS
AKSQPSYIPFLLREESSLNTGQGPTGLGDPGVLFLEAQDPQHGPDTDSDSDLSLEDDQSG
SYASTHSSDSEEEEDGAFPGEPGWDSLLGPGAERLPLHSTPKADSGPGPGKAPWPSDFVA
ATKENGGGGPEERFRENGDAVSRDGPLGPLPGCPPTAQPHKGILKKKCLPTISEKSHLLR
LPPEPGTGSSRGSSASEGSRAGPLPPRPPPRQTLQEQLNGVTPIAMSIKAGTVDEDSSGS
EFLFFNFLH
Download sequence
Identical sequences 13616.ENSMODP00000002583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]