SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000003585 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000003585
Domain Number 1 Region: 310-474,502-533
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.68e-24
Family Laminin G-like module 0.069
Further Details:      
 
Domain Number 2 Region: 122-229
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000005
Family Cadherin 0.0053
Further Details:      
 
Domain Number 3 Region: 10-134
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000443
Family Cadherin 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000003585
Sequence length 954
Comment (Monodelphis domestica)
Sequence
VNKHKPWIETTYHGIVTENDNTVLLDPPLIALDKDAPLHYAESFEVTVTKEGEICGFKIH
GQNVPFDAVVVDKSTGEGIIRSKEKLDCELQKDYTFTIQAYDCGKGPDGANSKKSHKATV
HIQVNDVNEYAPIFKEKSYKATVIEGKKYDNILKVEAVDADCSPQFSQICSYEIVTPDVP
FIIDKDGYIKNTEKLSYGKESQYKLTVTAYDCGKKRATEDVLVKISIKPTCKPGWQGWNK
RIEYEPGTGSLALFPNIHLETCDEPITSIQATVELETSHIGKGCDRDTYSEKSLHRLCGA
SSGTAELLPPPSSTLNWTVGLPTDNGHDSDQVFEFNGTQAVKIPEGVVTVNLKEPFMISV
WMRHGPGGRDKETILCNSDKTDMNRHHYSLYVHNCRLVFLFRQDPSEEKNYKPAEFHWKL
NQVCDKEWHHYVLNVEFPSVTLYVDGVSYDPFPVTEDYPLHPSKIETQLVVGACWQEYSG
NENDNETEAEAVTVTSAGGELHMAQFFRGNLAGLMIRSGKLENKKVIDCLYTCKEGLDLQ
VTDSKGMKVKNDQVQANPSQSVLTLEGDDIEQFEKAMQHISYLNSRQFPTPGIRRLQITS
TIKCFSEDACMSVPLVDGYVMVLQPEEPKISLSGINHFARAASEFESAEGVSLFPELRII
STITREVEQDADGDEEPTVQESLVSEEIMHNLDTCEITVLGQELNQDEESLEVDTARLQQ
KGIEMSSSSVGVIITGVDTMASYEELLHLVRYRNWHASASGLDRKFKLVCSELNGRYVSN
EFKVEVSVIHTANPVEHANHMAAQPQFVHPVHHSFVDLSGHNLANPHPFSVVPSTATVVI
VVCVSFLVFMIILGVFRIRAAHQRTMRDQDSGKENEMDWDDSALTITVNPMETYEDQHSS
EEEEEEEEEEESEDGEEEDDITSAESESSEEEEGEPEKDSITQQLEWDDSTLSY
Download sequence
Identical sequences 13616.ENSMODP00000003585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]