SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000003925 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000003925
Domain Number 1 Region: 37-171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.73e-35
Family Galectin (animal S-lectin) 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000003925
Sequence length 172
Comment (Monodelphis domestica)
Sequence
MAGSVAEREALEKLEDGHLNNSLGSPVQAEVYFPRLIVPFCGHIKGGMRPGKKILVMGIV
DLNPESFKISLTCGDSEDPPADVAIELKAVFTDKQLIRNSCISGERGEEQSAIPYFPFIP
DQPFRVEILCEHPRFRVFVDGHQLFDFYHRIETLSAIDTIKINGDLQITKLG
Download sequence
Identical sequences F6TYS8
13616.ENSMODP00000003925 ENSMODP00000003925 XP_001374836.1.35504 ENSMODP00000003925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]