SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000003933 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000003933
Domain Number 1 Region: 315-472
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.3e-43
Family SPRY domain 0.0000735
Further Details:      
 
Domain Number 2 Region: 31-97
Classification Level Classification E-value
Superfamily RING/U-box 2.08e-17
Family RING finger domain, C3HC4 0.0076
Further Details:      
 
Domain Number 3 Region: 117-166
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000626
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000003933
Sequence length 472
Comment (Monodelphis domestica)
Sequence
IQMSWTARESPGLTFHFLIRLRNMEAKELIESLKAELTCSICLGYFTDPVTALKCGHNFC
KDCLFQCGEQADATLTCPECRAVIRYSDIVLNENLQDLSITGKALRQKLLLSMALLTTCN
QHGEKEKLFCEQDQKLICESCLFTQEHEDHQDIPLQMAADKCKIIFVLQKKLEETWNMLQ
GKKEEFKRAIDELRISEAYFKELIKSEYRKMHEFLWKEENKHMQKLDQEVQDKLEKVKEN
EASLFQQIQHLQQRLLEIEEKTTRDHSHQFCTKSNCAHILMLLEKASKGVTELREVAFNL
QHLPSKVNYSISFSIADITLGPETDSFHLIAPEDFKHLKYGHDSQDQPDKEKTLDYFVTV
LGAQTFTSGTHYWEVDVEGQTEWVFGICEESVNKSGNVSIFSQDVRAVIALKLENHLLFW
CPSDFFYKLPTQKVGILLNYEEGHVSFYDIKDKCVLFSFPNSAFQGPVRPFF
Download sequence
Identical sequences 13616.ENSMODP00000003933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]