SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000004359 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000004359
Domain Number 1 Region: 157-251
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.48e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000004359
Sequence length 252
Comment (Monodelphis domestica)
Sequence
MEEVMETQNATEAEDNFTMISRTTGKRGKKRRAEGQQLEGQDSGGQMDIEGPLPQKKPVF
PPLSGDAFSGGQGEMRKIPVPANRYTPLKENWLKIFSPVVEHLGLQIRFNLKSRNVEIRT
CKETKDVSALTKAVDFVKAFILGFQVEDALALIRLDDLFLESFEVTDVKPLKGDHLSRAI
GRIAGKGGKTKFTIENVTRTRIVLADLKVHILGSFQNIKMARTAICNLILGSPPSKVYGN
IRAVASRAADRF
Download sequence
Identical sequences F7G112
ENSMODP00000004359 XP_001374559.2.35504 ENSMODP00000004359 13616.ENSMODP00000004359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]