SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000004447 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000004447
Domain Number 1 Region: 236-262,335-496
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-35
Family Laminin G-like module 0.000000178
Further Details:      
 
Domain Number 2 Region: 509-718
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-33
Family Laminin G-like module 0.00000043
Further Details:      
 
Domain Number 3 Region: 48-107
Classification Level Classification E-value
Superfamily GLA-domain 1.08e-20
Family GLA-domain 0.00055
Further Details:      
 
Domain Number 4 Region: 108-238
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000361
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000004447
Sequence length 723
Comment (Monodelphis domestica)
Sequence
MPPPQQQPAPAAALSTVLLLLLLATDSSQTVLLRAREATQFLRPRQRRANQIFEETKQGH
LERECIEELCNKEEAREVFENDPETDYFYPRYLDCIAKYGSPYLKNINFISCVRDLPDQC
TPYPCEKKGTVNCQDLMGTFYCQCKTGWSGRTCDQDVNECNHQNGGCSQICYNQIGGFSC
ACYTGYKLLLNNKTCEDIDECTDASACGEARCKNLLGSYSCICEEGYVYNNEKKVCQDVN
ECEEKLCEQTCVNSPGSYACHCDGRGGVKLSHDMNTCERESAIPLPLLKAMGGPRFKSGL
RHTSSVYGPNCLALTILLSWNQFLDILPCISFDVAKSVKSLYLGRMSNGAPVIRLRFKRL
KPTRVVAEFDFRTFDPEGVIFFAGGRQDNTWIMLALRAGRLELQLKYNNIGRVTSSGPVI
NNGMWQTISVEEVERNLVIKVNSDAVMKIAVSGELFQLYRGLYQLNLTVGGIPFKDKYLV
HPINTRLDGCMRSWNWLDGDDTTIQDIVKMNSRMQCFSVMSRGSFYPGNGFAYFSLNYTQ
PFVGDETQRTWGIEITVKIRPATDTGVLLALVSEEKTVPLSLALVDYHSTKKLKKQLVVL
AVEHIPMTFMEIKACDGQDHLVEVHIKEGEIALTVDGTKGQIEVSPSQLEERLSALKNYL
QRPLRTYTGGVPDVPVMSAPVTAFYHGCMTLTVNQKTLDLDEAMYKHGDITSHSCPPNEQ
AGP
Download sequence
Identical sequences 13616.ENSMODP00000004447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]