SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000004589 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000004589
Domain Number 1 Region: 11-99
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 4.97e-26
Family Cytochrome b5 0.0024
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000004589
Domain Number - Region: 342-390
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0422
Family Calponin-homology domain, CH-domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000004589
Sequence length 436
Comment (Monodelphis domestica)
Sequence
MAPHSVSAGAPPRLFTWDEVAQRSGRPERWLVIDRKVYDISEFSQRHPGGSRVISHYAGQ
DATDPFTAFHIDKSLVRKYMNSLLIGELAPDQPSFEPNKNPIHSIDSKTEGKGLKKNNEK
NPLDILVTMNTSGDGELMTRTWGMLSLHSMPTAALTGRLQLAGAQAGWLQHDFGHLSVCR
TSTWNHLIHHFVIGHLKGAPASWWNHLHFQHHAKPNCFRKDPDINMHPFFFALGKVLSVE
VRGSPKLVLYGEDRHRFSNLIGPPALLPVYFQWYIFYFVVQRKKWVDLAWMISFYLRISL
TYIPLLGLKGFLGLFFIVRFLESNWFVWVTQMNHIPMHIDHDRNVDWVSTQLQATCNVHE
SFFNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVRSLCAKHGIEYQSKPLLSAFADIVH
SLKESGQLWLDAYLQK
Download sequence
Identical sequences 13616.ENSMODP00000004589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]