SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000004876 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000004876
Domain Number 1 Region: 424-501,529-624
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-50
Family SPRY domain 0.0000913
Further Details:      
 
Domain Number 2 Region: 11-51,176-208
Classification Level Classification E-value
Superfamily RING/U-box 7.63e-18
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 217-278
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.36e-17
Family B-box zinc-binding domain 0.00076
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000004876
Domain Number - Region: 259-325
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0405
Family Apolipoprotein A-I 0.012
Further Details:      
 
Domain Number - Region: 503-537
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 0.0693
Family Obg GTP-binding protein N-terminal domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000004876
Sequence length 627
Comment (Monodelphis domestica)
Sequence
MAAVAMTPNPVQTLQEEAVCAICLDYFTDPVSIGCGHNFCRVCVTQLWGGEEEEDREEEE
DEGEEEEVEAVGASGGWDTPMREDEYEGDMEEEEVEEEEDEEFWTNSINGPTWDNMDYVW
DEDEEEDLDYYLGDVEEELRGEEEEEDEDEEVLEEDEEEELEPATPPPPAPAPRRRFTCP
QCRKTFPRRSFRPNLQLANMVQVIRQMHPAPRRGSRGNEQGVCPKHQEALKLFCEVDEEA
ICVVCRESRNHKQHSVVPLEEVVQEYKAKLQGHVEPLRKHLEAVQKLKAKEERRVTELKS
QMKTELAAVASEFGRLARFLADEQAGLERRLREQHEAQLGRAGAAAGRLGEQATQLSRLL
AEAQERSQQGGLRLLKDIKETFNRCEEVQLQPPEIWSPDPSHPHSHDFLTDAIVRKMSRM
FCQAARVDLTLDPDTAHPALALSPDRRGVRLAERRQELPDHPKRFSAECCVLGAQGFRSG
RHYWEVEVGGRRGWAVGAARESTRHKEKGGPGGGSGGGSGDATPSRHHHRRRRPHLPQQP
MFQREVWCVGTNGKRYQAQSSTEQTPLSPGDKPHRLGVYLDYEAGRLGFYNAETLGHVHT
FSAAFLGERVFPFFRVISKGTRIKLCP
Download sequence
Identical sequences F7FMU1
ENSMODP00000004876 ENSMODP00000004876 13616.ENSMODP00000004876 XP_001372311.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]