SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000005423 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000005423
Domain Number 1 Region: 229-395
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-42
Family SPRY domain 0.00026
Further Details:      
 
Domain Number 2 Region: 16-75
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000259
Family B-box zinc-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000005423
Sequence length 400
Comment (Monodelphis domestica)
Sequence
MSEKEPDQAPGPPEDSAPRCPEHDLELKWFCSSERRLVCASCKGLGGPCREHHVRRAEER
AEELRNKIVDQCEKLQLQSAGITKYMAEVLPRKNQNAATLASGAREIVIQRLGLVKNVCE
SEEQRLLEQVHTEEERAHQSILTQRSHWTEALQKLSTIRTNLVSMLTDLDDRSLVQSERE
IFERTEEAEGILDPQESEKLNFNQKCVRSPLLTQLWASAVLCCLSGTEDIQVDERTISPF
LRLSEDRKTLTFNPKKSKAYADGPERFDHWPNALASTSFQGGLHAWIVNVENSCAYKVGV
SSSQLPRKGSGSDTRLGHNAFSWVFSRYDQEFRFLHCGQYQPLALLRCPDRIGVLLDLAA
GELLFYEPTSGALLCSYHAQFEGPIFPVFAVADQKISIVQ
Download sequence
Identical sequences F6SVI5
ENSMODP00000005423 13616.ENSMODP00000005423 XP_001364233.1.35504 ENSMODP00000005423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]