SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000005606 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000005606
Domain Number 1 Region: 527-619
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.97e-26
Family Calponin-homology domain, CH-domain 0.0017
Further Details:      
 
Domain Number 2 Region: 172-240
Classification Level Classification E-value
Superfamily L domain-like 0.0000401
Family Rab geranylgeranyltransferase alpha-subunit, C-terminal domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000005606
Sequence length 671
Comment (Monodelphis domestica)
Sequence
MAAAIVAPPAVGGEETAAAARVPGSTGLPGSRSAERALEEAVATGTLNLSNRRLKQFPRG
TASGYDLSDITQAATPPVCFPCELLTAPSLLHSYAPPAWPGPYLSSLCINYHLPSSWQLL
EKCIPEAQPWPSLWCEKSSYPSSRLVLNWGILYSLRILLNTKLKESFPLWSKYLCLSLSH
FCSRPSAPFSSVLLELGDLPLVRLDFSCNHVSRIPSSFRRLRHLQVILLDSNPLQSPPAQ
ICLKGKLHIFKYLSSEAGERGVSGFGDLPPSHPSGFSPCPVEDLFPGRRYDGGLDSGFHS
VDSGSKRWSGNELTDEFSELSFRISELTQEPRGPREQREDRNGDGDPEQIDFIDSSVPGE
EEDRDAVEEQQPEEHKTSEIVERPPSARLVEPAGEERRRPDTLQLWQDRERRQQQKERYD
KQTWVRLVQMGSIGMILDLVFVHVWLVKDNSSKRSGPQPGVPVPSSTSPDLHIVCPATGP
SPQPLGPTQRPNSFLFRSSSQSSSGPFSSEPVLRPRQSPQTIENKEELMAQLRQVLESCL
QQPLPEDLSDTLANGVILCQLVNHLRPRSVPFIHVPSPAVPKLSALKARKNVESFLEACR
KMGVPEADLCLPSDLLQGTTQGLRTTMEAVKCGGGEGPLPLGLSPSLGGFAFFYVVLMFL
LYVTYARLLGS
Download sequence
Identical sequences F6R5K7
ENSMODP00000005606 ENSMODP00000005606 13616.ENSMODP00000005606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]