SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000006124 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000006124
Domain Number 1 Region: 44-197
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.24e-31
Family Calponin-homology domain, CH-domain 0.0022
Further Details:      
 
Domain Number 2 Region: 215-293
Classification Level Classification E-value
Superfamily GAS2 domain-like 8.76e-28
Family GAS2 domain 0.0000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000006124
Sequence length 699
Comment (Monodelphis domestica)
Sequence
SRKHLFFQVWFGDDLPLSPRSPLTPRHGPGLADVCQYDEWIAVRHEATLVPMQEDLAIWL
NGLLGVDVKAERLLEELDNGVLLCQLINVLQNTIKACCDSEELGDFPMRKMPCKKDAPSG
SFFARDNTANFLHWCRRVGVDETYLFESEGLVLHKDPRQVYLCLLEIGRIVSRYGVEPPV
LIKLEKEIELEETLLNTSGTLLPESPPKSCCHQGELHEAVKHIAEDPPCSCSHRFSIEYL
SEGRYRLGDKILFIRMLHGKHVMVRVGGGWDTLQGFLLKYDPCRVLQFATLEQKILAFQK
GISNESIPDSPARTPPPPLMDPMSAVNMIQKQNSRPGTPVSVLRAREKHTISKRPQSPAR
ACATPTPHLPTSLKAGHSNSGPSKVPNSSATASLQHLTRPKGAPKKPPSLAHPVSKSTSS
PDSLRTASSVSESLRKRVLSPDYPKAKCPPAQSSSGRPSPAHLSNKYSDKSEPKQLKHNY
DSSKYCAVSHSASPKPPKLPITSIRQASKASPSLQSPAKIAKSSSKSTTEKPGTAQPQPP
NREPQTRRDQMQKVNSIRNLSQPVSSASVMPAKTAQAATLLASNGKNVASETKKQPLNKS
KGLPMGSSLSKPSVRTPLSVVKLSQTSIKTPTSVKAAQPATKGQPLMKTPPKTSKTTNLS
TKKPLLSKKETVVDGDKPIPKKKEDDHYFVMSGNKKARK
Download sequence
Identical sequences 13616.ENSMODP00000006124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]