SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000007109 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000007109
Domain Number 1 Region: 81-162
Classification Level Classification E-value
Superfamily HMG-box 3.27e-32
Family HMG-box 0.0000207
Further Details:      
 
Domain Number 2 Region: 3-79
Classification Level Classification E-value
Superfamily HMG-box 3.4e-26
Family HMG-box 0.0000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000007109
Sequence length 188
Comment (Monodelphis domestica)
Sequence
MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKF
DEMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISI
GDVAKKLGEMWNNLSDNEKQPYNNKAAKLKEKYEKDVADYKSKGKFDGAKGAAKAARKKN
PEKQVMRF
Download sequence
Identical sequences F6QEC9
ENSMODP00000007109 ENSMODP00000007109 13616.ENSMODP00000007109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]