SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000008876 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000008876
Domain Number 1 Region: 388-563
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-38
Family SPRY domain 0.0014
Further Details:      
 
Domain Number 2 Region: 13-87
Classification Level Classification E-value
Superfamily RING/U-box 1.48e-18
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 3 Region: 145-210
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000443
Family B-box zinc-binding domain 0.00048
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000008876
Domain Number - Region: 90-137
Classification Level Classification E-value
Superfamily RING/U-box 0.0742
Family Zf-UBP 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000008876
Sequence length 569
Comment (Monodelphis domestica)
Sequence
QVKMSNNNSLCIFEDRVLCPICLEVFRNPVTTACGHNFCMNCLQDYWDHQAAMGETPYCP
QCREVFTSRPHLRKNVILGEIVACFTQNQTPAPNRAVAGPGDIPCDFCSPEKLKSVKSCL
QCAASLCENHLRTHYEDQVFQGHRLLEPIWDLKAQLCRKHRKLQRLYCRTEGCCVCGACL
LEEHKNHDTIPLEEERARKEVEVRKVQANVENQMLIIASDSQKHRGRVAFLTKLIQTVRE
DVNRCFADIGREVKRLQVKVLEFVEKEEAAALGQLGSSIQQSHSRLLELEGDSVWLRSLL
TNQSDQQFLEEFPRLKRFPACTESLLGTTCEETNSFPRLSEILAELRAQLAVVGLRFVNQ
LLLKGIKMRSYEVLPSAVDRKNLLKCYCNLNFDSATASEELFLFKETHSVLNLGILLEPY
ASGPFPGFNQWPQVLCTRSMAEGQHYWEAEVSNSWVCVGVTYSCSPPPSGRPRRNIVYLI
GRNSASWCLEWDSLKFSVWHNNTQTVLQGGYYRTIGVALDYPAGCLSFYGVAGGMSLIYR
FLTNFLEPLYPAVMVSSGASITLKQYPES
Download sequence
Identical sequences F6RD94
ENSMODP00000008876 ENSMODP00000008876 13616.ENSMODP00000008876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]