SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000011010 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000011010
Domain Number 1 Region: 4-106
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.49e-28
Family Calponin-homology domain, CH-domain 0.0001
Further Details:      
 
Domain Number 2 Region: 186-215
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000233
Family LIM domain 0.015
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000011010
Domain Number - Region: 216-245
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000124
Family LIM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000011010
Sequence length 987
Comment (Monodelphis domestica)
Sequence
MAAIKALQQWCRQQCEGYPGVSIVNMTTSFRDGLAFCAILHRHRPDLINFNSLRKENIYE
NNKLLFRVITDHIRIALLEAEDMVFLKVPDRLSILTYVSQYYNYFHGRSPIGGMAGVKRA
PSESSEEPKGKKAVSQADKPASLDPMQPLAPVRTNPIVQEKNTVTEFPPAKPGRVPTGGD
SPRGSRSSICAICKKHVHLVQRYLVDGKLYHRNCFRCKQCSSTLHSGAYKSTGEPGIFVC
MNHHTKASIPHSKSPHPDRKQPAAGYASRTNPVPMDTASPGVLRRAQEPDKLREVGQNTS
QPSREPVRNSPAKGLAQSSGWNSSSVGSSAMNSLSPSSPALQKSPSSTSSSPNPFLTRFT
QNSPVGGKPSVTNNSPVGWSPAPRKSEPLTTPSKLDLHTTSPQGKFSAATSEHRLDLGSS
SSPNSWTSCASKTQQAREKFFQPSCTSADKPPASKEYGLTFTSPQAAGKAPSGATVAPGQ
AVQERTKDKARSFLIQNLKAGLASNGPGSTAAQGPTRVEGTEFVQIGKNLHERQKPNTLR
CLTIMVESTEDLGKGLKKKDCRLRSNRSIPGLRSLRSLWFPILSLFPKLGLFRTPRHVFP
RASPVLRLTDSGSLPDGLRGVSKAKVEPASPRPGTMMELSSKSKPSTPASPQRVKKSPTF
SRPSQELLNPRQKPDTSGVNGQGPRSTENQIEDPAAWRSKLKPVEKISSVDKVSEQKEKV
TPTPIDTKGLALSKKPLENSSTSIEITLSSPLKDKASTSASALPSKSQASVPAPQGRKKL
SISPNLDVSDSWMKLEHKRDDATPPEKPSRLSKIEKPYIPTSFPISSNKEVKSPVKLHPD
YIPEEEIQKKIQDIEKELDSLELKGIDLEKKLREAEGDESEDALMVEWFKLIHEKQLLLR
QESELMYKAKEQRLEEMQLDIADELRRLMEKPEALKTPREKKREQDLLEQYVNTVNDRSD
IVDSLDEDRLREQEEDQVIQDMIQKLG
Download sequence
Identical sequences 13616.ENSMODP00000011010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]