SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000011878 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000011878
Domain Number 1 Region: 38-163
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.22e-21
Family Galectin (animal S-lectin) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000011878
Sequence length 164
Comment (Monodelphis domestica)
Sequence
QNGRISGQERAFEKLEEGHLKNSLVSPVQVEVYFPKLIVPFCEHTKGGMRPGKKISGMGI
VDLNSESFKISWTGGHSEDSLAGMVIELKAVLQNSCISGEEEQSAIPYFPFAPGQPLRME
ILCEHPRFRVFVNGHQLFDFYHQIETSAVDTIKINGDLQITKLG
Download sequence
Identical sequences 13616.ENSMODP00000011878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]